BRSK1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17226
Zusätzliche Namen:: BRSK1|hSAD1|SAD-B
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 90kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: PSNGELDPDVLESMASLGCFRDRERLHRELRSEEENQEKMIYYLLLDRKERYPSCEDQDLPPRNDVDPPRKRVDSPMLSRHGKRRPERKSMEVLSITDAGGGGSPVPTRRALEMAQHSQRSRSVSGASTGLSSSPLSSPRSPVFSFSPEPGAGDEARGGGSPTSKTQTLPSRGPRGGGAGEQPPPPSARSTPLPGPPGSPR
Uniprot:: Q8TDC3
Synonyme:: BR serine/threonine-protein kinase 1;brain-selective kinase 1;brain-specific serine/threonine-protein kinase 1;hSAD1;protein kinase SAD1A;SAD1 homolog;SAD1 kinase;serine/threonine-protein kinase BRSK1;serine/threonine-protein kinase SAD-B;synapses of Amphids Defective homolog 1
Weitere Details:: Enables magnesium ion binding activity; protein serine/threonine kinase activity; and tau-protein kinase activity. Involved in mitotic G2 DNA damage checkpoint signaling and protein phosphorylation. Acts upstream of or within G2/M transition of mitotic cell cycle; peptidyl-serine phosphorylation; and response to UV. Located in cell junction; cytoplasm; and nucleoplasm.