A17223
MIXL1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17223
- Zusätzliche Namen:
- MILD1|MIX|MIXL|MIXL1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 23kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- QPLARPEIILNHCAPGTETKCLKPQLPLEVDVNCLPEPNGVGGGISDSSSQGQNFETCSPLSEDIGSKLDSWEEHIFSAFGNF
- Uniprot:
- Q9H2W2
- Synonyme:
- homeobox protein MIXL1;homeodomain protein MIX;MILD1;MIX;Mix-like homeobox protein 1;mix.1 homeobox-like protein;MIX1 homeobox-like protein 1;MIXL
- Weitere Details:
- Enables RNA polymerase II-specific DNA-binding transcription factor binding activity and sequence-specific double-stranded DNA binding activity. Predicted to be involved in several processes, including endodermal cell differentiation; hematopoietic progenitor cell differentiation; and positive regulation of mesoderm development. Predicted to act upstream of or within cell migration involved in gastrulation and hemopoiesis. Located in nucleoplasm.
- Versandbedingungen:
- Blue Ice