ANP32E Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17220
Zusätzliche Namen:: ANP32E|LANP-L|LANPL
Anwendung:: ELISA, WB
Molekulargewicht:: 31 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MEMKKKINLELRNRSPEEVTELVLDNCLCVNGEIEGLNDTFKELEFLSMANVELSSLARLPSLNKLRKLE
Uniprot:: Q9BTT0
Synonyme:: acidic (leucine-rich) nuclear phosphoprotein 32 family, member E;acidic leucine-rich nuclear phosphoprotein 32 family member E;LANP-L;LANP-like protein;LANPL;leucine-rich acidic nuclear protein like
Weitere Details:: Enables histone binding activity. Involved in histone exchange. Located in nucleus. Part of Swr1 complex.