CYBRD1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17215
Zusätzliche Namen:: CYB561A2|CYBRD1|DCYTB|FRRS3
Anwendung:: ELISA, WB
Molekulargewicht:: 36kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: IFWIVTRPQWKRPKEPNSTILHPNGGTEQGARGSMPAYSGNNMDKSDSELNSEVAARKRNLALDEAGQRSTM
Uniprot:: Q53TN4
Synonyme:: CYB561A2;cytochrome b561 family, member A2;DCYTB;duodenal cytochrome b;ferric-chelate reductase 3;FRRS3;plasma membrane ascorbate-dependent reductase CYBRD1
Weitere Details:: This gene is a member of the cytochrome b(561) family that encodes an iron-regulated protein. It highly expressed in the duodenal brush border membrane. It has ferric reductase activity and is believed to play a physiological role in dietary iron absorption.