A17202
CLSPN Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17202
- Zusätzliche Namen:
- claspin|CLSPN
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 275kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- SVPKSLSSDSTLLLFKDSSSKMGYFPTEEKSETDENSGKQPSKLDEDDSCSLLTKESSHNSSFELIGSTIPSYQPCNRQTGRGTSFFPTAGGFRSPSPGLF
- Uniprot:
- Q9HAW4
- Synonyme:
- claspin;claspin homolog
- Weitere Details:
- The product of this gene is an essential upstream regulator of checkpoint kinase 1 and triggers a checkpoint arrest of the cell cycle in response to replicative stress or DNA damage. The protein is also required for efficient DNA replication during a normal S phase. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice