CELA2A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17200
Zusätzliche Namen:: AOMS4|CELA2A|ELA2A|PE-1
Anwendung:: ELISA, WB, IF
Molekulargewicht:: 29kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: TYRVGLGRHNLYVAESGSLAVSVSKIVVHKDWNSNQISKGNDIALLKLANPVSLTDKIQLACLPPAGTILP
Uniprot:: P08217
Synonyme:: AOMS4;chymotrypsin like elastase family member 2A;chymotrypsin-like elastase family member 2A;ELA2A;elastase 2A;Elastase-2A;pancreatic elastase 2;pancreatic elastase IIA;PE-1
Weitere Details:: Elastases form a subfamily of serine proteases that hydrolyze many proteins in addition to elastin. Humans have six elastase genes which encode the structurally similar proteins elastase 1, 2, 2A, 2B, 3A, and 3B. Like most of the human elastases, elastase 2A is secreted from the pancreas as a zymogen. In other species, elastase 2A has been shown to preferentially cleave proteins after leucine, methionine, and phenylalanine residues.