PPP4R3B Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17189
Zusätzliche Namen:: FLFL2|PP4R3B|PPP4R3B|PSY2|SMEK2|smk1
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 97kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: YKALESIEYVQTFKGLKTKYEQEKDRQNQKLNSVPSILRSNRFRRDAKALEEDEEMWFNEDEEEEGKAVVAPVEKPKPEDDFPDNYEKFMETKKAKESEDKENLPKRTSPGGFKFTFSHSASAANGTNSKSVVAQIPPATSNGSSSKTTNLPTSVTATKGSLVGLVDYPDDEEEDEEEESSPRKRPRLGS
Uniprot:: Q5MIZ7
Synonyme:: FLFL2;PP4R3B;PSY2;serine/threonine-protein phosphatase 4 regulatory subunit 3B;SMEK homolog 2;SMEK homolog 2, suppressor of mek1;SMEK2;smk1
Weitere Details:: Predicted to act upstream of or within positive regulation of gluconeogenesis and protein dephosphorylation. Located in centrosome and nuclear speck.