A17188
VGLUT1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17188
- Zusätzliche Namen:
- BNPI|SLC17A7|VGLUT1
- Anwendung:
- ELISA, WB, IF
- Molekulargewicht:
- 55kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MEFRQEEFRKLAGRALGKLHRLLEKRQEGAETLELSADGRPVTTQTRDPPVVDCTCFGLPRRYIIAIMSGLGFCISFGIRCNLGVAIVSMVNNSTTHRGG
- Uniprot:
- Q9P2U7
- Synonyme:
- BNPI;brain-specific Na-dependent inorganic phosphate cotransporter;brain-specific Na(+)-dependent inorganic phosphate cotransporter;solute carrier family 17 (sodium-dependent inorganic phosphate cotransporter), member 7;solute carrier family 17 (vesicular glutamate transporter), member 7;Solute carrier family 17 member 7;vesicular glutamate transporter 1;VGLUT1
- Weitere Details:
- The protein encoded by this gene is a vesicle-bound, sodium-dependent phosphate transporter that is specifically expressed in the neuron-rich regions of the brain. It is preferentially associated with the membranes of synaptic vesicles and functions in glutamate transport. The protein shares 82% identity with the differentiation-associated Na-dependent inorganic phosphate cotransporter and they appear to form a distinct class within the Na+/Pi cotransporter family.
- Versandbedingungen:
- Blue Ice





