RAPGEF6 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17161
Zusätzliche Namen:: KIA001LB|PDZ-GEF2|PDZGEF2|RA-GEF-2|RAGEF2|RAPGEF6
Anwendung:: ELISA, WB
Molekulargewicht:: 179kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: INYKGERQTITDDVEVNSYLSLPADLTKMHLTENPHPQVTHVSSSQSGCSIASDSGSSSLSDIYQATESEVGDVDLTRLPEGPVDSEDDEEEDEEI
Uniprot:: Q8TEU7
Synonyme:: KIA001LB;PDZ domain containing guanine nucleotide exchange factor (GEF) 2;PDZ domain-containing guanine nucleotide exchange factor 2;PDZ domain-containing guanine nucleotide exchange factor I;PDZ-GEF2;PDZGEF2;RA-GEF-2;RAGEF2;Rap guanine nucleotide exchange factor (GEF) 6;rap guanine nucleotide exchange factor 6
Weitere Details:: Enables several functions, including GTP-dependent protein binding activity; guanyl-nucleotide exchange factor activity; and phosphatidic acid binding activity. Involved in microvillus assembly; positive regulation of GTPase activity; and protein localization to plasma membrane. Located in several cellular components, including apical plasma membrane; centrosome; and endocytic vesicle.