CYB5R1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17160
Zusätzliche Namen:: B5R.1|B5R1|B5R2|CYB5R1|humb5R2|NQO3A2
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MGIQTSPVLLASLGVGLVTLLGLAVGSYLVRRSRRPQVTLLDPNEKYLLRLLDKTTVSHNTKRFRFALPTAHHTLGLPVGKHIYLSTRIDGSLVIRPYTPVTSDEDQGYVDLVIKVYLKGVHPKFPEGGKMSQYLDSLKVGDVVEFRGPSGLLTYTGKGHFNIQPNKKSPPEPRVAKKLGMIAGGTGITPMLQLIRAILKVPEDPTQCFLLFANQTEKDIILREDLEELQARYPNRFKLWFTLDHPPKDWAYSKGFVTADMIREHLPAPGDDVLVLLCGPPPMVQLACHPNLDKLGYSQKMRFTY
Uniprot:: Q9UHQ9
Synonyme:: B5R.1;B5R1;B5R2;humb5R2;NAD(P)H:quinone oxidoreductase type 3 polypeptide A2;NAD(P)H:quinone oxidoreductase type 3, polypeptide A2;NADH-cytochrome b5 reductase 1;NQO3A2
Weitere Details:: Predicted to enable FAD binding activity. Predicted to be involved in bicarbonate transport. Located in extracellular exosome; membrane; and mitochondrion.