TMX2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17148
Zusätzliche Namen:: CGI-31|NEDMCMS|PDIA12|PIG26|TMX2|TXNDC14
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: KPPLYMGPEYIKYFNDKTIDEELERDKRVTWIVEFFANWSNDCQSFAPIYADLSLKYNCTGLNFGKVDVGRYTDVSTRYKVSTSPLTKQLPTLILFQGGKEAMRRPQIDKKGRAVSWTFSEENVIREFNLNELYQRAKKLSKAGDNIPEEQPVASTPTTVSDGENKKDK
Uniprot:: Q9Y320
Synonyme:: cell proliferation-inducing gene 26 protein;CGI-31;growth-inhibiting gene 11;NEDMCMS;PDIA12;PIG26;protein disulfide isomerase family A, member 12;thioredoxin domain-containing protein 14;thioredoxin-related transmembrane protein 2;TXNDC14
Weitere Details:: This gene encodes a member of the disulfide isomerase (PDI) family of endoplasmic reticulum (ER) proteins that catalyze protein folding and thiol-disulfide interchange reactions. The encoded protein has an N-terminal ER-signal sequence, a catalytically active thioredoxin domain, one transmembrane domain and a C-terminal ER-retention sequence. This protein is enriched on the mitochondria-associated-membrane of the ER via palmitoylation of two of its cytosolically exposed cysteines.