CPSF1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17144
Zusätzliche Namen:: CPSF1|CPSF160|HSU37012|MYP27|P/cl.18
Anwendung:: ELISA, WB
Molekulargewicht:: 170kDa/185kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: LYRDLSGMFTTESRLGGARDELGGRSGPEAEGLGSETSPTVDDEEEMLYGDSGSLFSPSKEEARRSSQPPADRDPAPFRAEPTHWCLLVRENGTMEIYQLPDWRLVFLVKNFPVGQRVLVDSSFGQPTTQGEARREEATRQGELPLVKEVLLVALGSRQSRPYLLVHVDQELLIYEAFPHDSQLGQGNLKVRFKKVPHNINFREKKPKPSKKKAEGGGAEEGAGARGRVARFRYFEDIYGYSGVFICGPSP
Uniprot:: Q10570
Synonyme:: cleavage and polyadenylation specific factor 1, 160kDa;cleavage and polyadenylation specificity factor 160 kDa subunit;cleavage and polyadenylation specificity factor subunit 1;CPSF 160 kDa subunit;CPSF160;HSU37012;MYP27;P/cl.18;polyadenylation specificity factor
Weitere Details:: Cleavage and polyadenylation specificity factor (CPSF) is a multisubunit complex that plays a central role in 3-prime processing of pre-mRNAs. CPSF recognizes the AAUAAA signal in the pre-mRNA and interacts with other proteins to facilitate both RNA cleavage and poly(A) synthesis. CPSF1 is the largest subunit of the CPSF complex (Murthy and Manley, 1995 [PubMed 7590244]).