A17130
CNNM4 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17130
- Zusätzliche Namen:
- ACDP4|CNNM4
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 100kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- VRALVDLQYIKITRQQYQNGLLASRMENSPQFPIDGCTTHMENLAEKSELPVVDETTTLLNERNSLLHKASHENAI
- Uniprot:
- Q6P4Q7
- Synonyme:
- ACDP4;ancient conserved domain protein 4;ancient conserved domain-containing protein 4;cyclin-M4;metal transporter CNNM4
- Weitere Details:
- This gene encodes a member of the ancient conserved domain containing protein family. Members of this protein family contain a cyclin box motif and have structural similarity to the cyclins. The encoded protein may play a role in metal ion transport. Mutations in this gene are associated with Jalili syndrome which consists of cone-rod dystrophy and amelogenesis imperfecta.
- Versandbedingungen:
- Blue Ice