A17116
KAT6B Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17116
- Zusätzliche Namen:
- GTPTS|KAT6B|MORF|MOZ2|MYST4|qkf|querkopf|ZC2HC6B
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 280kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- DLDVFKQAQELSWEKIECESGVEDCGRYPSVIEFGKYEIQTWYSSPYPQEYARLPKLYLCEFCLKYMKSKNILLRHSKKCGWFHPPANEIYRRKDLSVFEV
- Uniprot:
- Q8WYB5
- Synonyme:
- GTPTS;histone acetyltransferase KAT6B;histone acetyltransferase MORF;histone acetyltransferase MOZ2;histone acetyltransferase MYST4;K(lysine) acetyltransferase 6B;monocytic leukemia zinc finger protein-related factor;MORF;MOZ-related factor;MOZ, YBF2/SAS3, SAS2 and TIP60 protein 4;MOZ2;MYST histone acetyltransferase (monocytic leukemia) 4;MYST-4;MYST4;qkf;querkopf;ZC2HC6B
- Weitere Details:
- The protein encoded by this gene is a histone acetyltransferase and component of the MOZ/MORF protein complex. In addition to its acetyltransferase activity, the encoded protein has transcriptional activation activity in its N-terminal end and transcriptional repression activity in its C-terminal end. This protein is necessary for RUNX2-dependent transcriptional activation and could be involved in brain development. Mutations have been found in patients with genitopatellar syndrome. A translocation of this gene and the CREBBP gene results in acute myeloid leukemias. Three transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice