A17107
ARL6IP1 Rabbit polyclonal antibody
Größe
Auf Anfrage
- SKU:
- A17107
- Zusätzliche Namen:
- AIP1|ARL6IP|ARL6IP1|ARMER|SPG61
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 22kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MAEGDNRSTNLLAAETASLEEQLQGWGEVMLMADKVLRWERAWFPPAIMGVVSLVFLIIYYLDPSVLSGVSCFVMFLCLADYLVPILAPRIFGSNKWTTE
- Uniprot:
- Q15041
- Synonyme:
- ADP-ribosylation factor GTPase 6 interacting protein 1;ADP-ribosylation factor-like 6 interacting protein 1;ADP-ribosylation factor-like protein 6-interacting protein 1;aip-1;AIP1;apoptotic regulator in the membrane of the endoplasmic reticulum;ARL-6-interacting protein 1;ARL6IP;ARMER;SPG61
- Weitere Details:
- This gene belongs to the ARL6ip family and encodes a transmembrane protein that is predominantly localized to intracytoplasmic membranes. It is highly expressed in early myeloid progenitor cells and thought to be involved in protein transport, membrane trafficking, or cell signaling during hematopoietic maturation. Mutations in this gene are associated with spastic paraplegia 61 (SPG61). Alternatively spliced transcript variants have been found for this gene.
- Versandbedingungen:
- Blue Ice