A1709
MMP12 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1709
- Zusätzliche Namen:
- HME|ME|MME|MMP-12|MMP12
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 45kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- DEFWTTHSGGTNLFLTAVHEIGHSLGLGHSSDPKAVMFPTYKYVDINTFRLSADDIRGIQSLYGDPKENQRLPNPDNSEPALCDPNLSFDAVTTVGNKIFF
- Uniprot:
- P39900
- Synonyme:
- HME;Macrophage elastase;macrophage metalloelastase;matrix metallopeptidase 12 (macrophage elastase);matrix metalloproteinase 12 (macrophage elastase);Matrix metalloproteinase-12;ME;MME;MMP-12
- Weitere Details:
- This gene encodes a member of the peptidase M10 family of matrix metalloproteinases (MMPs). Proteins in this family are involved in the breakdown of extracellular matrix in normal physiological processes, such as embryonic development, reproduction, and tissue remodeling, as well as in disease processes, such as arthritis and metastasis. The encoded preproprotein is proteolytically processed to generate the mature protease. This protease degrades soluble and insoluble elastin. This gene may play a role in aneurysm formation and mutations in this gene are associated with lung function and chronic obstructive pulmonary disease (COPD). This gene is part of a cluster of MMP genes on chromosome 11.
- Versandbedingungen:
- Blue Ice