RPP40 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17086
Zusätzliche Namen:: bA428J1.3|RNASEP1|RPP40
Anwendung:: ELISA, WB
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: LSLNLDSKKYERISWSFKEKKPLKFDFLLAWHKTGSEESTMMSYFSKYQIQEHQPKVALSTLRDLQCPVLQSSELEGTPEV
Uniprot:: O75818
Synonyme:: bA428J1.3;ribonuclease P (40 kD);ribonuclease P protein subunit p40;ribonuclease P, 40kD subunit;ribonuclease P/MRP 40kDa subunit;ribonuclease P1;RNase P subunit 1;RNaseP protein p40;RNASEP1
Weitere Details:: Enables ribonuclease P RNA binding activity. Contributes to ribonuclease P activity. Involved in tRNA 5'-leader removal. Part of multimeric ribonuclease P complex.