[KO Validated] VAT1 Rabbit polyclonal antibody

Größe

Auf Anfrage

SKU:: A17077
Zusätzliche Namen:: T1|VATI
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 42kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: GVGMAAVQLCRTVENVTVFGTASASKHEALKENGVTHPIDYHTTDYVDEIKKISPKGVDIVMDPLGGSDTAKGYNLLKPMGKVVTYGMANLLTGPKRNLMA
Uniprot:: Q99536
Synonyme:: membrane protein of cholinergic synaptic vesicles;synaptic vesicle membrane protein VAT-1 homolog;VATI;vesicle amine transport protein 1 homolog (T. californica)
Weitere Details:: Synaptic vesicles are responsible for regulating the storage and release of neurotransmitters in the nerve terminal. The protein encoded by this gene is an abundant integral membrane protein of cholinergic synaptic vesicles and is thought to be involved in vesicular transport. It belongs to the quinone oxidoreductase subfamily of zinc-containing alcohol dehydrogenase proteins.