TMEM147 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17076
Zusätzliche Namen:: NEDFLPH|NIFIE14|TMEM147
Anwendung:: ELISA, WB
Molekulargewicht:: 25kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: MTLFHFGNCFALAYFPYFITYKCSGLSEYNAFWKCVQAGVTYLFVQLCKMLFLATFFPTWEGGIYDFIGEFMKASVDVADLIGLNLVMSRNAGKGEYKIM
Uniprot:: Q9BVK8
Synonyme:: NIFIE14;protein NIFIE 14;seven transmembrane domain protein;transmembrane protein 147
Weitere Details:: Enables ribosome binding activity. Located in endoplasmic reticulum membrane. Part of protein-containing complex.