A17062
KEAP1 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A17062
- Zusätzliche Namen:
- INrf2|KEAP1|KLHL19
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 60-64kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- LVKIFEELTLHKPTQVMPCRAPKVGRLIYTAGGYFRQSLSYLEAYNPSDGTWLRLADLQVPRSGLAGCVVGGLLYAVGGRNNSPDGNTDSSALDCYNPMT
- Uniprot:
- Q14145
- Synonyme:
- cytosolic inhibitor of Nrf2;INrf2;KEAP1 delta C;kelch-like ECH-associated protein 1;kelch-like family member 19;kelch-like protein 19;KLHL19
- Weitere Details:
- This gene encodes a protein containing KELCH-1 like domains, as well as a BTB/POZ domain. Kelch-like ECH-associated protein 1 interacts with NF-E2-related factor 2 in a redox-sensitive manner and the dissociation of the proteins in the cytoplasm is followed by transportation of NF-E2-related factor 2 to the nucleus. This interaction results in the expression of the catalytic subunit of gamma-glutamylcysteine synthetase. Two alternatively spliced transcript variants encoding the same isoform have been found for this gene.
- Versandbedingungen:
- Blue Ice



