A17055
ATP5J2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17055
- Zusätzliche Namen:
- ATP5J2|ATP5JL
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 11kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MASVGECPAPVPVKDKKLLEVKLGELPSWILMRDFSPSGIFGAFQRGYYRYYNKYINVKKGSISGITMVLACYVLFSYSFSYKHLKHERLRKYH
- Uniprot:
- P56134
- Synonyme:
- ATP synthase f chain, mitochondrial;ATP synthase subunit f, mitochondrial;ATP synthase, H+ transporting, mitochondrial F0 complex, subunit f;ATP synthase, H+ transporting, mitochondrial Fo complex subunit F2;ATP5J2;ATP5JL;F1F0-type ATPase subunit f;F1Fo-ATP synthase complex Fo membrane domain f subunit;F1Fo-ATPase synthase f subunit
- Weitere Details:
- Mitochondrial ATP synthase catalyzes ATP synthesis, utilizing an electrochemical gradient of protons across the inner membrane during oxidative phosphorylation. It is composed of two linked multi-subunit complexes: the soluble catalytic core, F1, and the membrane-spanning component, Fo, which comprises the proton channel. The catalytic portion of mitochondrial ATP synthase consists of five different subunits (alpha, beta, gamma, delta, and epsilon) assembled with a stoichiometry of 3 alpha, 3 beta, and single representatives of the gamma, delta, and epsilon subunits. The proton channel likely has nine subunits (a, b, c, d, e, f, g, F6 and 8). This gene encodes the f subunit of the Fo complex. Alternatively spliced transcript variants encoding different isoforms have been identified for this gene. This gene has multiple pseudogenes. Naturally occurring read-through transcription also exists between this gene and the downstream pentatricopeptide repeat domain 1 (PTCD1) gene.
- Versandbedingungen:
- Blue Ice

