LY86 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17051
Zusätzliche Namen:: dJ80N2.1|LY86|MD-1|MD1|MMD-1
Anwendung:: ELISA, WB
Molekulargewicht:: 18kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: DFGFSVEKCSKQLKSNINIRFGIILREDIKELFLDLALMSQGSSVLNFSYPICEAALPKFSFCGRRKGEQIYYAGPVNNPEFTIPQGEYQVLLELYTEKRS
Uniprot:: O95711
Synonyme:: dJ80N2.1;ly-86;lymphocyte antigen 86;MD-1;MD-1, RP105-associated;MD1;MMD-1;protein MD-1
Weitere Details:: Acts upstream of or within positive regulation of lipopolysaccharide-mediated signaling pathway. Predicted to be located in extracellular space.