A17048
TAOK2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A17048
- Zusätzliche Namen:
- MAP3K17|PSK|PSK1|PSK1-BETA|TAO1|TAO2|Tao2beta|TAOK2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 138kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- AEWLLRQKEQLQQCQAEEEAGLLRRQRQYFELQCRQYKRKMLLARHSLDQDLLREDLNKKQTQKDLECALLLRQHEATRELELRQLQAVQRTRAELTRLQHQTELGNQLEYNKRREQELRQ
- Uniprot:
- Q9UL54
- Synonyme:
- hKFC-C;kinase from chicken homolog C;MAP3K17;prostate derived STE20-like kinase PSK;prostate-derived STE20-like kinase 1;prostate-derived sterile 20-like kinase 1;PSK;PSK-1;PSK1;PSK1-BETA;serine/threonine-protein kinase TAO2;TAO1;TAO2;thousand and one amino acid protein kinase 2
- Weitere Details:
- Enables mitogen-activated protein kinase kinase binding activity; neuropilin binding activity; and protein serine/threonine kinase activity. Involved in several processes, including focal adhesion assembly; intracellular signal transduction; and positive regulation of JNK cascade. Located in cytoplasmic vesicle; cytosol; and nuclear lumen. Part of receptor complex.
- Versandbedingungen:
- Blue Ice

_WB_01.jpg)