PIGQ Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17044
Zusätzliche Namen:: c407A10.1|DEE77|EIEE77|GPI1|GPIBD19|MCAHS4|PIGQ
Anwendung:: ELISA, WB
Molekulargewicht:: 84kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MVLKAFFPTCCVSTDSGLLVGRWVPEQSSAVVLAVLHFPFIPIQVKQLLAQVRQASQVGVAVLGTWCHCRQEPEESLGRFLESLGAVFPHEPWLRLCRERGGTFWSCEATHRQAPTAPGAPGEDQVMLIFYDQRQVLLSQLHLPTVLPDRQAGATTASTGGLAAVFDTVARSEVLFRSDRFDEGPVRLSHWQSEGVEASI
Uniprot:: Q9BRB3
Synonyme:: c407A10.1;c407A10.1 (GPI1 (N-acetylglucosaminyl transferase component));DEE77;EIEE77;GPI1;N-acetylglucosaminyl transferase component Gpi1;N-acetylglucosamyl transferase component GPI1;phosphatidylinositol glycan, class Q;phosphatidylinositol N-acetylglucosaminyltransferase subunit Q;phosphatidylinositol-glycan biosynthesis class Q protein;PIG-Q
Weitere Details:: This gene is involved in the first step in glycosylphosphatidylinositol (GPI)-anchor biosynthesis. The GPI-anchor is a glycolipid found on many blood cells and serves to anchor proteins to the cell surface. This gene encodes a N-acetylglucosaminyl transferase component that is part of the complex that catalyzes transfer of N-acetylglucosamine (GlcNAc) from UDP-GlcNAc to phosphatidylinositol (PI). Alternatively spliced transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice