EIF2S2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17040
Zusätzliche Namen:: eIF-2-beta|EIF2|EIF2B|EIF2beta|EIF2S2|PPP1R67
Anwendung:: ELISA, WB
Molekulargewicht:: 38kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MSGDEMIFDPTMSKKKKKKKKPFMLDEEGDTQTEETQPSETKEVEPEPTEDKDLEADEEDTRKKDASDDLDDLNFFNQKKKKKKTKKIFDIDEAEEGVKDLKIESDVQEPTEPEDDLDIMLGNKKKKKKNVKFPDEDEILEKDEALEDEDNKKDDGISFSNQTGPAWAGSERDYT
Uniprot:: P20042
Synonyme:: eIF-2-beta;EIF2;EIF2B;EIF2beta;eukaryotic translation initiation factor 2 subunit 2;Eukaryotic translation initiation factor 2 subunit beta;eukaryotic translation initiation factor 2, subunit 2 beta, 38kDa;PPP1R67;protein phosphatase 1, regulatory subunit 67
Weitere Details:: Eukaryotic translation initiation factor 2 (EIF-2) functions in the early steps of protein synthesis by forming a ternary complex with GTP and initiator tRNA and binding to a 40S ribosomal subunit. EIF-2 is composed of three subunits, alpha, beta, and gamma, with the protein encoded by this gene representing the beta subunit. The beta subunit catalyzes the exchange of GDP for GTP, which recycles the EIF-2 complex for another round of initiation. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice