Beclin 1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A17028
Zusätzliche Namen:: ATG6|Beclin 1|beclin1|VPS30
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: LKLDTSFKILDRVTIQELTAPLLTTAQAKPGETQEEETNSGEEPFIETPRQDGVSRRFIPPARMMSTESANSFTLIGEASDGGTMENLSRRLKVTGDLFDIMSGQTDVDHPLCEECTDTLLDQLDTQLNVTENECQNYKRCLEILEQMNEDDSEQLQMELKELALEEERLIQELEDVEKNRKIVAENLEKVQAEAERLDQEEAQYQREYSEFKRQQLELDDELKSVENQMRYAQTQLDKLKKTNVFNATFHIWHSG
Uniprot:: Q14457
Synonyme:: ATG6;ATG6 autophagy related 6 homolog;beclin 1 (coiled-coil, moesin-like BCL2-interacting protein);beclin 1, autophagy related;beclin-1;beclin1;coiled-coil myosin-like BCL2-interacting protein;Protein GT197;testis secretory sperm-binding protein Li 215e;VPS30
Weitere Details:: This gene encodes a protein that regulates autophagy, a catabolic process of degradation induced by starvation. The encoded protein is a component of the phosphatidylinositol-3-kinase (PI3K) complex which mediates vesicle-trafficking processes. This protein is thought to play a role in multiple cellular processes, including tumorigenesis, neurodegeneration and apoptosis. Alternative splicing results in multiple transcript variants.