A17003
WIPF1 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A17003
- Zusätzliche Namen:
- PRPL-2|WAS2|WASPIP|WIP|WIPF1
- Anwendung:
- ELISA, WB, IHC-P
- Molekulargewicht:
- 51kda
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- QLPSRSGVDSPRSGPRPPLPPDRPSAGAPPPPPPSTSIRNGFQDSPCEDEWESRFYFHPISDLPPPEPYVQTTKSYPSKLARNESRSGSNRRERGAPPLPP
- Uniprot:
- O43516
- Synonyme:
- protein PRPL-2;PRPL-2;testicular tissue protein Li 226;WAS/WASL-interacting protein family member 1;WAS2;WASP-interacting protein;WASPIP;WIP;Wiskott-Aldrich syndrome protein interacting protein;Wiskott-Aldrich syndrome protein-interacting protein
- Weitere Details:
- This gene encodes a protein that plays an important role in the organization of the actin cytoskeleton. The encoded protein binds to a region of Wiskott-Aldrich syndrome protein that is frequently mutated in Wiskott-Aldrich syndrome, an X-linked recessive disorder. Impairment of the interaction between these two proteins may contribute to the disease. Two transcript variants encoding the same protein have been identified for this gene.
- Versandbedingungen:
- Blue Ice