NPR3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16932
Zusätzliche Namen:: ANP-C|ANPR-C|ANPRC|BOMOS|C5orf23|GUCY2B|NPR-C|NPR3|NPRC
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 70kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: AALVYSDDKLERNCYFTLEGVHEVFQEEGLHTSIYSFDETKDLDLEDIVRNIQASERVVIMCASSDTIRSIMLVAHRHGMTSGDYAFFNIELFNSSSYGDGSWKRGDKHDFEAKQAYSSLQTVTLLRTVKPEFEKFSMEVKSSVEKQGLNMEDYVNMFVEGFHDAILLYVLALHEVLRAGYSKKDGGKIIQQTWNRTFEGIAGQVSIDANGDRYGDFSVIAMTDVEAGTQEVIGDYFGKEGRFEMRPNVKYPWGPLKLRIDENRIVEHTNSSPCKSSGGLE
Uniprot:: P17342
Synonyme:: ANP-C;ANPR-C;ANPRC;atrial natriuretic peptide clearance receptor;atrial natriuretic peptide receptor 3;atrial natriuretic peptide receptor type C;atrionatriuretic peptide receptor C;C5orf23;guanylate cyclase C;GUCY2B;natriuretic peptide receptor C/guanylate cyclase C (atrionatriuretic peptide receptor C);NPR-C;NPRC
Weitere Details:: This gene encodes one of three natriuretic peptide receptors. Natriutetic peptides are small peptides which regulate blood volume and pressure, pulmonary hypertension, and cardiac function as well as some metabolic and growth processes. The product of this gene encodes a natriuretic peptide receptor responsible for clearing circulating and extracellular natriuretic peptides through endocytosis of the receptor. Multiple transcript variants encoding different isoforms have been found for this gene.

Versandbedingungen:: Blue Ice