NPAS2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16930
Zusätzliche Namen:: bHLHe9|MOP4|NPAS2|PASD4
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 75kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: KTTVLEKVIGFLQKHNEVSAQTEICDIQQDWKPSFLSNEEFTQLMLEALDGFIIAVTTDGSIIYVSDSITPLLGHLPSDVMDQNLLNFLPEQEHSEVYKILSSHMLVTDSPSPEYLKSDSDLEFYCHLLRGSLNPKEFPTYEYIKFVGNFRSYNNVPSPSCNGFDNTLSRPCRVPLGKEVCFIATVRLATPQFLKE
Uniprot:: Q99743
Synonyme:: basic-helix-loop-helix-PAS protein MOP4;bHLHe9;class E basic helix-loop-helix protein 9;member of PAS protein 4;member of PAS superfamily 4;MOP4;neuronal PAS domain-containing protein 2;neuronal PAS2;PAS domain-containing protein 4;PASD4
Weitere Details:: The protein encoded by this gene is a member of the basic helix-loop-helix (bHLH)-PAS family of transcription factors. A similar mouse protein may play a regulatory role in the acquisition of specific types of memory. It also may function as a part of a molecular clock operative in the mammalian forebrain.