MUC4 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16922
Zusätzliche Namen:: ASGP|HSA276359|MUC-4|MUC4
Anwendung:: ELISA, WB
Molekulargewicht:: 540kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Sequenz:: RCSCVSFSIYTAWGEHCEHLSMKLDAFFGIFFGALGGLLLLGVGTFVVLRFWGCSGARFSYFLNSAEALP
Uniprot:: Q99102
Synonyme:: ascites sialoglycoprotein;ASGP;HSA276359;MUC-4;mucin 4, tracheobronchial;mucin-4;pancreatic adenocarcinoma mucin;testis mucin;tracheobronchial mucin
Weitere Details:: The major constituents of mucus, the viscous secretion that covers epithelial surfaces such as those in the trachea, colon, and cervix, are highly glycosylated proteins called mucins. These glycoproteins play important roles in the protection of the epithelial cells and have been implicated in epithelial renewal and differentiation. This gene encodes an integral membrane glycoprotein found on the cell surface, although secreted isoforms may exist. At least two dozen transcript variants of this gene have been found, although for many of them the full-length transcript has not been determined or they are found only in tumor tissues. This gene contains a region in the coding sequence which has a variable number (>100) of 48 nt tandem repeats.