A16913
Smad3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16913
- Zusätzliche Namen:
- hMAD-3|hSMAD3|HSPC193|HsT17436|JV15-2|LDS1C|LDS3|mad3|MADH3|Smad3
- Anwendung:
- ELISA, WB, IF, ICC
- Molekulargewicht:
- 52kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- FPPLDDYSHSIPENTNFPAGIEPQSNIPETPPPGYLSEDGETSDHQMNHSMDAGSPNLSPNPMSPAHNNLDLQPVTYCEPAFWCSISYYELNQRVGETFHA
- Uniprot:
- P84022
- Synonyme:
- hMAD-3;hSMAD3;HSPC193;HsT17436;JV15-2;LDS1C;LDS3;MAD homolog 3;mad homolog JV15-2;mad protein homolog;MAD, mothers against decapentaplegic homolog 3;mad3;MADH3;mothers against decapentaplegic homolog 3;mothers against DPP homolog 3;SMA- and MAD-related protein 3;SMAD family member 3;SMAD, mothers against DPP homolog 3
- Weitere Details:
- The SMAD family of proteins are a group of intracellular signal transducer proteins similar to the gene products of the Drosophila gene 'mothers against decapentaplegic' (Mad) and the C. elegans gene Sma. The SMAD3 protein functions in the transforming growth factor-beta signaling pathway, and transmits signals from the cell surface to the nucleus, regulating gene activity and cell proliferation. This protein forms a complex with other SMAD proteins and binds DNA, functioning both as a transcription factor and tumor suppressor. Mutations in this gene are associated with aneurysms-osteoarthritis syndrome and Loeys-Dietz Syndrome 3.
- Versandbedingungen:
- Blue Ice