A16880
IFNA10 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16880
- Zusätzliche Namen:
- IFN-alphaC|IFNA10
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 25kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- CDLPQTHSLGNRRALILLGQMGRISPFSCLKDRHDFRIPQEEFDGNQFQKAQAISVLHEMIQQTFNLFSTEDSSAAW
- Uniprot:
- P01566
- Synonyme:
- IFN-alpha-10;IFN-alphaC;interferon alpha-10;interferon alpha-6L;interferon alpha-C;leIF C
- Weitere Details:
- This gene encodes a protein that belongs to the type I interferon family of proteins, and is located in a cluster of alpha interferon genes on chromosome 9. Interferons are small regulatory molecules that function in cell signaling in response to viruses and other pathogens or tumor cells. This gene is intronless and the encoded protein is secreted.
- Versandbedingungen:
- Blue Ice