GAP43 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16857
Zusätzliche Namen:: B-50|GAP-43|GAP43|PP46
Anwendung:: ELISA, WB, IHC-P
Molekulargewicht:: Refer to figures
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: MLCCMRRTKQVEKNDDDQKIEQDGIKPEDKAHKAATKIQASFRGHITRKKLKGEKKDDVQAAEAEANKKDEAPVADGVEKKGEGTTTAEAAPATGSKPDEPGKAGETPSEEKKGEGDAATEQAAPQAPASSEEKAGSAETESATKASTDNSPSSKAEDAPAKEEPKQADVPAAVTAAAATTPAAEDAAAKATAQPPTETGESSQAEENIEAVDETKPKESARQDEGKEEEPEADQEHA
Uniprot:: P17677
Synonyme:: axonal membrane protein GAP-43;B-50;calmodulin-binding protein P-57;GAP-43;Growth-associated protein 43;nerve growth-related peptide GAP43;neural phosphoprotein B-50;neuromodulin;neuron growth-associated protein 43;PP46;protein F1
Weitere Details:: The protein encoded by this gene has been termed a 'growth' or 'plasticity' protein because it is expressed at high levels in neuronal growth cones during development and axonal regeneration. This protein is considered a crucial component of an effective regenerative response in the nervous system. Alternatively spliced transcript variants encoding distinct isoforms have been found for this gene.