A16852
FOXI1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16852
- Zusätzliche Namen:
- FKH10|FKHL10|FOXI1|FREAC-6|FREAC6|HFH-3|HFH3
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 37kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MSSFDLPAPSPPRCSPQFPSIGQEPPEMNLYYENFFHPQGVPSPQRPSFEGGGEYGATPNPYLWFNGPTMTPPPYLPGPNASPFLPQAYGVQRPLLPSVS
- Uniprot:
- Q12951
- Synonyme:
- FKH10;FKHL10;forkhead box protein I1;forkhead-like 10;forkhead-related activator 6;forkhead-related protein FKHL10;forkhead-related transcription factor 6;FREAC-6;FREAC6;hepatocyte nuclear factor 3 forkhead homolog 3;HFH-3;HFH3;HNF-3/fork-head homolog-3
- Weitere Details:
- This gene belongs to the forkhead family of transcription factors, which is characterized by a distinct forkhead domain. This gene may play an important role in the development of the cochlea and vestibulum, as well as in embryogenesis. The encoded protein has been found to be required for the transcription of four subunits of a proton pump found in the inner ear, the kidney, and the epididymis. Mutations in this gene have been associated with deafness, autosomal recessive 4.
- Versandbedingungen:
- Blue Ice

