A16850
FGF3 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16850
- Zusätzliche Namen:
- FGF3|HBGF-3|INT2
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 27kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- MGLIWLLLLSLLEPGWPAAGPGARLRRDAGGRGGVYEHLGGAPRRRKLYCATKYHLQLHPSGRVNGSLENSAYSILEITAVEVGIVAIRGLFSGRYLAMN
- Uniprot:
- P11487
- Synonyme:
- FGF-3;fibroblast growth factor 3;fibroblast growth factor 3 (murine mammary tumor virus integration site (v-int-2) oncogene homolog);HBGF-3;heparin-binding growth factor 3;INT-2 proto-oncogene protein;INT2;murine mammary tumor virus integration site 2, mouse;oncogene INT2;proto-oncogene Int-2;V-INT2 murine mammary tumor virus integration site oncogene homolog
- Weitere Details:
- The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities and are involved in a variety of biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene was identified by its similarity with mouse fgf3/int-2, a proto-oncogene activated in virally induced mammary tumors in the mouse. Frequent amplification of this gene has been found in human tumors, which may be important for neoplastic transformation and tumor progression. Studies of the similar genes in mouse and chicken suggested the role in inner ear formation.
- Versandbedingungen:
- Blue Ice

