A16845
ETS2 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16845
- Zusätzliche Namen:
- ETS2|ETS2IT1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- Refer to figures
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- SSLLDVQRVPSFESFEDDCSQSLCLNKPTMSFKDYIQERSDPVEQGKPVIPAAVLAGFTGSGPIQLWQFLLELLSDKSCQSFISWTGDGWEFKLADPDEVA
- Uniprot:
- P15036
- Synonyme:
- ETS2IT1;oncogene ETS-2;protein C-ets-2;v-ets avian erythroblastosis virus E2 oncogene homolog 2;v-ets avian erythroblastosis virus E26 oncogene homolog 2;v-ets erythroblastosis virus E26 oncogene homolog 2
- Weitere Details:
- This gene encodes a transcription factor which regulates genes involved in development and apoptosis. The encoded protein is also a protooncogene and shown to be involved in regulation of telomerase. A pseudogene of this gene is located on the X chromosome. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

