A16785
CACNA1D Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16785
- Zusätzliche Namen:
- CACH3|CACN4|CACNA1D|CACNL1A2|Cav1.3|CCHL1A2|PASNA|SANDD
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 245kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Sequenz:
- RQNYGYYSRYPGRNIDSERPRGYHHPQGFLEDDDSPVCYDSRRSPRRRLLPPTPASHRRSSFNFECLRRQSSQEEVPSSPIFPHRTALPLHLMQQQIMAVAGLDSSKAQKYSPSHSTRSWATPPATPPYRDWTPCYTPLIQVEQSEALDQVNGSLPSLHRSSWYTDEPDISYRTFTPASLTVPSSFRNKNSDKQRSADSLVEAVLISEGLGRYARDPKFVSATKHEIADACDLTIDEMESAASTLLNGNVRPRANGDVGPLSHRQDYELQDFGPGYSDEEPDPGRDEEDLADEMICITTL
- Uniprot:
- Q01668
- Synonyme:
- CACH3;CACN4;CACNL1A2;calcium channel, L type, alpha-1 polypeptide;Calcium channel, L type, alpha-1 polypeptide, isoform 2;calcium channel, neuroendocrine/brain-type, alpha 1 subunit;calcium channel, voltage-dependent, L type, alpha 1D subunit;Cav1.3;CCHL1A2;PASNA;SANDD;voltage-dependent L-type calcium channel subunit alpha-1D;voltage-gated calcium channel alpha 1 subunit;voltage-gated calcium channel alpha subunit Cav1.3;Voltage-gated calcium channel subunit alpha Cav1.3
- Weitere Details:
- Voltage-dependent calcium channels mediate the entry of calcium ions into excitable cells, and are also involved in a variety of calcium-dependent processes, including muscle contraction, hormone or neurotransmitter release, and gene expression. Calcium channels are multisubunit complexes composed of alpha-1, beta, alpha-2/delta, and gamma subunits. The channel activity is directed by the pore-forming alpha-1 subunit, whereas the others act as auxiliary subunits regulating this activity. The distinctive properties of the calcium channel types are related primarily to the expression of a variety of alpha-1 isoforms, namely alpha-1A, B, C, D, E, and S. This gene encodes the alpha-1D subunit. Several transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

