A16781
C3 Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16781
- Zusätzliche Namen:
- ASP|C3|HSE-MSF|Plp
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 115kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse, Rat
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Sequenz:
- EGQVNSLPGSINKAGEYIEASYMNLQRPYTVAIAGYALALMNKLEEPYLGKFLNTAKDRNRWEEPDQQLYNVEATSYALLALLLLKDFDSVPPVVRWLNEQRYYGGGYGSTQATFMVFQALAQYQTDV
- Uniprot:
- P01027
- Synonyme:
- acylation stimulating protein;acylation-stimulating protein cleavage product;AHUS5;AI255234;ARMD9;ASP;C3 and PZP-like alpha-2-macroglobulin domain-containing protein 1;C3a;C3a anaphylatoxin;C3b;complement C3;complement component 3;complement component 3d;complement component C3a;complement component C3b;complement factor 3;CPAMD1;epididymis secretory sperm binding protein Li 62p;HEL-S-62p;HSE-MSF;Plp;prepro-C3
- Weitere Details:
- This gene encodes complement protein C3 which plays a central role in the classical, alternative and lectin activation pathways of the complement system. The encoded preproprotein undergoes a multi-step processing to generate various functional peptides. Mice deficient in the encoded protein fail to clear bacteria from the blood stream upon infection, display diminished airway hyperresponsiveness and lung eosinophilia upon allergen-induced pulmonary allergy, and develop severe lung injury after deposition of IgG immune complexes. Deficiency of the homolog of the encoded protein in humans was found to be associated with increased susceptibility to infections, age-related macular degeneration, and atypical hemolytic uremic syndrome.
- Versandbedingungen:
- Blue Ice