TRIM72 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16751
Zusätzliche Namen:: MG53|TRIM72
Anwendung:: ELISA, WB
Molekulargewicht:: 53kda
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: DAGVALRRELSSLNSYLEQLRQMEKVLEEVADKPQTEFLMKFCLVTSRLQKILSESPPPARLDIQLPVISDDFKFQVWKKMFRALMPALEELTFDPSSAHP
Uniprot:: Q1XH17
Synonyme:: BC067209;MG53;mitsugumin 53;mitsugumin-53;tripartite motif containing 72, E3 ubiquitin protein ligase;tripartite motif-containing protein 72
Weitere Details:: Enables identical protein binding activity. Predicted to be involved in several processes, including cellular protein metabolic process; plasma membrane repair; and protein homooligomerization. Predicted to act upstream of or within negative regulation of insulin receptor signaling pathway; negative regulation of insulin-like growth factor receptor signaling pathway; and negative regulation of myotube differentiation. Predicted to be located in cytoplasmic vesicle membrane. Predicted to be active in cytoplasm and sarcolemma.