Gsdmc3 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16741
Zusätzliche Namen:: 9930109F21Rik|Gsdmc3
Anwendung:: ELISA, WB
Molekulargewicht:: 54kDa
Spezies-Reaktivität:: Mouse
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: GYSFDRASKDVVKKLQGRDLRPVECLSDATKFRLFHILQETPRSGWETEDIPVGFTLLDLLEPNFPVPEPEVSAPKPFI
Uniprot:: Q8CB12
Synonyme:: 9930109F21Rik;gasdermin-C;gasdermin-C3;melanoma-derived leucine zipper-containing extranuclear factor;melanoma-derived leucine zipper, extra-nuclear factor;MLZE
Weitere Details:: Predicted to enable phosphatidylinositol-4,5-bisphosphate binding activity; phosphatidylinositol-4-phosphate binding activity; and phosphatidylserine binding activity. Predicted to be involved in defense response to bacterium and pyroptosis. Predicted to act upstream of or within programmed cell death. Predicted to be located in cytoplasm. Is expressed in gut and metanephros. Orthologous to human GSDMC (gasdermin C).