SRSF7 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16738
Zusätzliche Namen:: 9G8|AAG3|SFRS7|SRSF7
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 35kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: AEDAVRGLDGKVICGSRVRVELSTGMPRRSRFDRPPARRPFDPNDRCYECGEKGHYAYDCH
Uniprot:: Q16629
Synonyme:: 9G8;AAG3;aging-associated protein 3;serine/arginine-rich splicing factor 7;SFRS7;splicing factor 9G8;Splicing factor, arginine/serine-rich 7;splicing factor, arginine/serine-rich 7, 35kDa;SR splicing factor 7
Weitere Details:: The protein encoded by this gene is a member of the serine/arginine (SR)-rich family of pre-mRNA splicing factors, which constitute part of the spliceosome. Each of these factors contains an N-terminal RNA recognition motif (RRM) for binding RNA and a C-terminal RS domain for binding other proteins. The RS domain is rich in serine and arginine residues and facilitates interaction between different SR splicing factors. In addition to being critical for mRNA splicing, the SR proteins have also been shown to be involved in mRNA export from the nucleus and in translation. Multiple transcript variants encoding different isoforms have been found for this gene.