FCN2 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16690
Zusätzliche Namen:: EBP-37|FCN2|FCNL|ficolin-2|P35
Anwendung:: ELISA, WB
Molekulargewicht:: 34kda
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Sequenz:: SAGDSLTFHNNQSFSTKDQDNDLNTGNCAVMFQGAWWYKNCHVSNLNGRYLRGTHGSFANG
Uniprot:: Q15485
Synonyme:: 37 kDa elastin-binding protein;collagen/fibrinogen domain-containing protein 2;EBP-37;FCNL;ficolin (collagen/fibrinogen domain containing lectin) 2 (hucolin);ficolin B;ficolin-2;Ficolin-B;ficolin-beta;Hucolin;L-ficolin;P35;serum lectin p35
Weitere Details:: The product of this gene belongs to the ficolin family of proteins. This family is characterized by the presence of a leader peptide, a short N-terminal segment, followed by a collagen-like region, and a C-terminal fibrinogen-like domain. This gene is predominantly expressed in the liver, and has been shown to have carbohydrate binding and opsonic activities. Alternatively spliced transcript variants encoding different isoforms have been identified.