LSM14A Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16682
Zusätzliche Namen:: C19orf13|FAM61A|LSM14A|RAP55|RAP55A
Anwendung:: ELISA, WB, IF, ICC
Molekulargewicht:: 50 kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Mouse, Rat
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: MSGGTPYIGSKISLISKAEIRYEGILYTIDTENSTVALAKVRSFGTEDRPTDRPIPPRDEVFEYIIFRGSDIKDLTVCEPPKPQCSLPQDPAIVQSSLGS
Uniprot:: Q8ND56
Synonyme:: alphaSNBP;C19orf13;FAM61A;family with sequence similarity 61, member A;hRAP55;hRAP55A;LSM14 homolog A;LSM14A, SCD6 homolog A;Protein FAM61A;protein LSM14 homolog A;protein SCD6 homolog;putative alpha-synuclein-binding protein;RAP55;RAP55A;RNA-associated protein 55;RNA-associated protein 55A
Weitere Details:: Sm-like proteins were identified in a variety of organisms based on sequence homology with the Sm protein family (see SNRPD2; 601061). Sm-like proteins contain the Sm sequence motif, which consists of 2 regions separated by a linker of variable length that folds as a loop. The Sm-like proteins are thought to form a stable heteromer present in tri-snRNP particles, which are important for pre-mRNA splicing.