A1668
CHGA Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A1668
- Zusätzliche Namen:
- CGA|CHGA|PHE5|PHES
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 80kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- EEEEEEEAEAGEEAVPEEEGPTVVLNPHPSLGYKEIRKGESRSEALAVDGAGKPGAEEAQDPEGKGEQEHSQQKEEEEEMAVVPQGLFRGGKSGELEQEEERLSKEWEDSKRWSKMDQLAKELTAEKRLEGQEEEEDNRDSSMKLSFRARA
- Uniprot:
- P10645
- Synonyme:
- betagranin (N-terminal fragment of chromogranin A);catestatin;CGA;chromofungin;chromogranin-A;parathyroid secretory protein 1;pituitary secretory protein I;SP-I
- Weitere Details:
- The protein encoded by this gene is a member of the chromogranin/secretogranin family of neuroendocrine secretory proteins. It is found in secretory vesicles of neurons and endocrine cells. This gene product is a precursor to three biologically active peptides; vasostatin, pancreastatin, and parastatin. These peptides act as autocrine or paracrine negative modulators of the neuroendocrine system. Two other peptides, catestatin and chromofungin, have antimicrobial activity and antifungal activity, respectively. Two transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice