A16649
NFAT5 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16649
- Zusätzliche Namen:
- NF-AT5|NFAT5|NFATL1|NFATZ|OREBP|TONEBP
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 174kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- NQLQNSPGSSQQTSGMFLFGIQNNCSQLLTSGPATLPDQLMAISQPGQPQNEGQPPVTTLLSQQMPENSPLASSINTNQNIEKIDLLVSLQNQGNNLTGSF
- Uniprot:
- O94916
- Synonyme:
- glutamine rich protein H65;NF-AT5;NFAT-like protein 1;NFATL1;NFATZ;nuclear factor of activated T-cells 5;nuclear factor of activated T-cells 5, tonicity-responsive;OREBP;osmotic response element-binding protein;T-cell transcription factor NFAT5;TonE-binding protein;TONEBP;tonicity-responsive enhancer-binding protein
- Weitere Details:
- The product of this gene is a member of the nuclear factors of activated T cells family of transcription factors. Proteins belonging to this family play a central role in inducible gene transcription during the immune response. This protein regulates gene expression induced by osmotic stress in mammalian cells. Unlike monomeric members of this protein family, this protein exists as a homodimer and forms stable dimers with DNA elements. Multiple transcript variants encoding different isoforms have been found for this gene.
- Versandbedingungen:
- Blue Ice

