A16645
[KO Validated] CHCHD2 Rabbit polyclonal antibody

Größe
Auf Anfrage
- SKU:
- A16645
- Zusätzliche Namen:
- C7orf17|D2|MIX17B|MNRR1|NS2TP|PARK22
- Anwendung:
- ELISA, WB, IHC-P, IF, ICC
- Molekulargewicht:
- 16kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human, Mouse, Rat
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- TLGHAITGGFSGGSNAEPARPDITYQEPQGTQPAQQQQPCLYEIKQFLECAQNQGDIKLCEGFNEVLKQCR
- Uniprot:
- Q9Y6H1
- Synonyme:
- 16.7kD protein;aging-associated gene 10 protein;C7orf17;coiled-coil-helix-coiled-coil-helix domain-containing protein 2;coiled-coil-helix-coiled-coil-helix domain-containing protein 2, mitochondrial;HCV NS2 trans-regulated protein;mitochondria nuclear retrograde regulator 1;mitochondrial nuclear retrograde regulator 1;MIX17 homolog B;MIX17B;MNRR1;NS2TP;PARK22
- Weitere Details:
- The protein encoded by this gene belongs to a class of eukaryotic CX(9)C proteins characterized by four cysteine residues spaced ten amino acids apart from one another. These residues form disulfide linkages that define a CHCH fold. In response to stress, the protein translocates from the mitochondrial intermembrane space to the nucleus where it binds to a highly conserved 13 nucleotide oxygen responsive element in the promoter of cytochrome oxidase 4I2, a subunit of the terminal enzyme of the electron transport chain. In concert with recombination signal sequence-binding protein J, binding of this protein activates the oxygen responsive element at four percent oxygen. In addition, it has been shown that this protein is a negative regulator of mitochondria-mediated apoptosis. In response to apoptotic stimuli, mitochondrial levels of this protein decrease, allowing BCL2-associated X protein to oligomerize and activate the caspase cascade. Pseudogenes of this gene are found on multiple chromosomes. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_1.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_2.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_3.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_4.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_5.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_W371_WB_01.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_W371(KO)_KO-WB_01.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_W371_IHC_01.jpg)
![[KO Validated] CHCHD2 Rabbit polyclonal antibody](https://abclonal-us.oss-us-east-1.aliyuncs.com/abclonal/Catalog/A16645/A16645_W371_IHC_02.jpg)