USP14 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16643
Zusätzliche Namen:: TGT|Ubp6|USP14
Anwendung:: ELISA, WB
Molekulargewicht:: 60kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: KYEPFSFADDIGSNNCGYYDLQAVLTHQGRSSSSGHYVSWVKRKQDEWIKFDDDKVSIVTPEDILRLSGGGDWHIAYVLLYGPRRVEIMEEESEQ
Uniprot:: P54578
Synonyme:: deubiquitinating enzyme 14;TGT;tRNA-guanine transglycosylase, 60-kD subunit;ubiquitin carboxyl-terminal hydrolase 14;ubiquitin specific peptidase 14 (tRNA-guanine transglycosylase);ubiquitin specific protease 14 (tRNA-guanine transglycosylase);ubiquitin thioesterase 14;ubiquitin thiolesterase 14;ubiquitin-specific processing protease 14;Ubiquitin-specific-processing protease 14
Weitere Details:: This gene encodes a member of the ubiquitin-specific processing (UBP) family of proteases that is a deubiquitinating enzyme (DUB) with His and Cys domains. This protein is located in the cytoplasm and cleaves the ubiquitin moiety from ubiquitin-fused precursors and ubiquitinylated proteins. Mice with a mutation that results in reduced expression of the ortholog of this protein are retarded for growth, develop severe tremors by 2 to 3 weeks of age followed by hindlimb paralysis and death by 6 to 10 weeks of age. Alternate transcriptional splice variants, encoding different isoforms, have been characterized.

Versandbedingungen:: Blue Ice