Human Thioredoxin Reductase 1/TRXR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16631
Zusätzliche Namen:: GRIM-12|Thioredoxin reductase 1 (TXNRD1 )|TR|TR1|TRXR1|TXNR
Anwendung:: ELISA, WB, IHC-P, IF, ICC
Molekulargewicht:: 65kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human, Mouse, Rat
Immunogen:: Recombinant protein (or fragment).This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: EAGTPGRLRVVAQSTNSEEIIEGEYNTVMLAIGRDACTRKIGLETVGVKINEKTGKIPVTDEEQTNVPYIYAIGDILEDKV
Uniprot:: Q16881
Synonyme:: gene associated with retinoic and IFN-induced mortality 12 protein;gene associated with retinoic and interferon-induced mortality 12 protein;GRIM-12;KM-102-derived reductase-like factor;oxidoreductase;selenoprotein TXNRD1;testis tissue sperm-binding protein Li 46a;thioredoxin reductase 1, cytoplasmic;thioredoxin reductase GRIM-12;thioredoxin reductase TR1;TR;TR1;TRXR1;TXNR
Weitere Details:: The protein encoded by this gene belongs to the pyridine nucleotide-disulfide oxidoreductase family, and is a member of the thioredoxin (Trx) system. Three thioredoxin reductase (TrxR) isozymes are found in mammals. TrxRs are selenocysteine-containing flavoenzymes, which reduce thioredoxins, as well as other substrates, and play a key role in redox homoeostasis. This gene encodes an ubiquitously expressed, cytosolic form of TrxR, which functions as a homodimer containing FAD, and selenocysteine (Sec) at the active site. Sec is encoded by UGA codon that normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, the Sec insertion sequence (SECIS) element, which is necessary for the recognition of UGA as a Sec codon rather than as a stop signal. Alternative splicing, primarily at the 5' end, results in transcript variants encoding same or different isoforms, including a glutaredoxin-containing isoform that is predominantly expressed in testis.

Versandbedingungen:: Blue Ice