A16622
Cpsf4l Rabbit polyclonal antibody
Größe
£152.00
- SKU:
- A16622
- Zusätzliche Namen:
- 0610010C04Rik|1500000C01Rik|Cpsf4l|D11Ertd636e
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 22kDa
- Spezies-Reaktivität:
- Mouse
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Mouse
- Immunogen:
- Recombinant protein (or fragment).This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- MEEVIAGLQGFTFAFELDVESQKGTGLLPFQGMDKSSSAVCNFFAKGLCVKGMLCPLRHEQGEKLVVCKHWLRGLCRKSDCCDFLHQYDVSKMPVCYFHSKFGNCSNKECLFLHLKPVLKLQDCPWYNQGFCKEVGPLCKYRHVHQVLCPNYFTGFCPEGPQCQFGHPKMSPPFHPSNVKLQPVNQPWDSTTSTGNTLVSPFQAKPMVHGQRRWSLPQACSSRAHPAP
- Uniprot:
- A6NMK7
- Synonyme:
- 0610010C04Rik;1500000C01Rik;D11Ertd636;D11Ertd636e;putative cleavage and polyadenylation specificity factor subunit 4-like protein
- Weitere Details:
- Predicted to be involved in pre-mRNA cleavage required for polyadenylation. Predicted to be part of mRNA cleavage and polyadenylation specificity factor complex. Is expressed in central nervous system and retina. Orthologous to human CPSF4L (cleavage and polyadenylation specific factor 4 like).
- Versandbedingungen:
- Blue Ice