A16618
NPSR1 Rabbit polyclonal antibody

Größe
£152.00
- SKU:
- A16618
- Zusätzliche Namen:
- ASRT2|GPR154|GPRA|NPSR|NPSR1|PGR14|VRR1
- Anwendung:
- ELISA, WB
- Molekulargewicht:
- 43kDa
- Spezies-Reaktivität:
- Human
- Aufreinigung:
- Affinity Purified
- Lagerbedingungen:
- -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
- Hersteller:
- Abclonal
- Host:
- Rabbit
- Reaktivitäten:
- Human
- Immunogen:
- Synthetic peptide. This information is considered to be commercially sensitive.
- Formulierung:
- Unmodified
- Sequenz:
- SKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI
- Uniprot:
- Q6W5P4
- Synonyme:
- ASRT2;G-protein coupled receptor 154;G-protein coupled receptor for asthma susceptibility;G-protein coupled receptor PGR14;GPR154;GPRA;neuropeptide S receptor;NPSR;PGR14;vasopressin receptor-related receptor 1;VRR1
- Weitere Details:
- This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants.
- Versandbedingungen:
- Blue Ice

