NPSR1 Rabbit polyclonal antibody

Größe

£152.00

SKU:: A16618
Zusätzliche Namen:: ASRT2|GPR154|GPRA|NPSR|NPSR1|PGR14|VRR1
Anwendung:: ELISA, WB
Molekulargewicht:: 43kDa
Spezies-Reaktivität:: Human
Aufreinigung:: Affinity Purified
Lagerbedingungen:: -20[o]C 50% glycerol. Avoid freeze/thaw cycles.
Hersteller:: Abclonal
Host:: Rabbit
Reaktivitäten:: Human
Immunogen:: Synthetic peptide. This information is considered to be commercially sensitive.
Formulierung:: Unmodified
Sequenz:: SKAKIKAIKYSIIIILAFICCWSPYFLFDILDNFNLLPDTQERFYASVIIQNLPALNSAINPLIYCVFSSSISFPCREQRSQDSRMTFRERTERHEMQILSKPEFI
Uniprot:: Q6W5P4
Synonyme:: ASRT2;G-protein coupled receptor 154;G-protein coupled receptor for asthma susceptibility;G-protein coupled receptor PGR14;GPR154;GPRA;neuropeptide S receptor;NPSR;PGR14;vasopressin receptor-related receptor 1;VRR1
Weitere Details:: This gene encodes a member of the vasopressin/oxytocin subfamily of G protein-coupled receptors. The encoded membrane protein acts as a receptor for neuropeptide S and affects a variety of cellular processes through its signaling. Increased expression of this gene in ciliated cells of the respiratory epithelium and in bronchial smooth muscle cells is associated with asthma. Polymorphisms in this gene have also been associated with asthma susceptibility, panic disorders, inflammatory bowel disease, and rheumatoid arthritis. Alternative splicing results in multiple transcript variants.